General Information

  • ID:  hor001084
  • Uniprot ID:  A0A8B6XSP5
  • Protein name:  Hydra-RFamide 3
  • Gene name:  LOC100213338
  • Organism:  Hydra vulgaris (Hydra) (Hydra attenuata)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hydra (genus), Hydridae (family), Aplanulata (suborder), Anthoathecata (order), Hydroidolina (subclass), Hydrozoa (class), Cnidaria (phylum), Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  KPHLRGRF
  • Length:  8
  • Propeptide:  MLNHKIETFLVWGLIIVAVAKSEEKNFSAEDRKDVKRIVNDYLNIKNGEQLMTGRFGKRVTDEDIDNEIESEYENEYEDELENLANGREDAAQWFNGRFGREIGGRILPRFATESNKPHLRGRFGRAAKM
  • Signal peptide:  MLNHKIETFLVWGLIIVAVAKS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001084_AF2.pdbhor001084_ESM.pdb

Physical Information

Mass: 113524 Formula: C46H75N17O9
Absent amino acids: ACDEIMNQSTVWY Common amino acids: R
pI: 12.52 Basic residues: 4
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -143.75 Boman Index: -3121
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 48.75
Instability Index: 1278.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8954943
  • Title:  Isolation of Four Novel Neuropeptides, the hydra-RFamides I-IV, From Hydra Magnipapillata